What's your name in DNA? deCode
www.ebi.ac.uk/training/schools/decode/ (unfortunately this EBI link is now dead)
or
www.ebi.ac.uk/cgi-bin/decode/decode.cgi
Duncan's personalised decode results
name = *DXNCAN*
Why has decode put some 'X's in my name?
There are only 20 amino acids encoded by DNA, so there might be some
letters in your name that do not stand for any amino acids (O or Z, for
example). Decode replaces these letters with an X, which means 'any
amino acid'.
Duncan's name in DNA:
GACNNNAACTGCGCCAAC
This DNA sequence is similar to the protein called Q9VDN2|MT3_DROME.
This protein is found in the species Drosophila melanogaster, more commonly known as Fruit fly.
>Q9VDN2|MT3_DROME Metallothionein-3 (MT-3) (Metallothionein C) - Drosophila melanogaster (Fruit fly)
sequence:
MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK
What's your name in DNA? deCode
www.ebi.ac.uk/training/schools/decode/ (unfortunately this EBI link is now dead)
or
www.ebi.ac.uk/cgi-bin/decode/decode.cgi
Duncan's personalised decode results
name = *DXNCAN*
Why has decode put some 'X's in my name?
There are only 20 amino acids encoded by DNA, so there might be some
letters in your name that do not stand for any amino acids (O or Z, for
example). Decode replaces these letters with an X, which means 'any
amino acid'.
Duncan's name in DNA:
GACNNNAACTGCGCCAAC
This DNA sequence is similar to the protein called Q9VDN2|MT3_DROME.
This protein is found in the species Drosophila melanogaster, more commonly known as Fruit fly.
>Q9VDN2|MT3_DROME Metallothionein-3 (MT-3) (Metallothionein C) - Drosophila melanogaster (Fruit fly)
sequence:
MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK