Back to photostream

Best Web Development Services all over the world

Qattaf tech Helps Businesses take their Technology to the next level. Get an Instant Quote for our Top-Rated digital services in the San Gabriel Valley & Throughout Los Angeles County.

Qattaf tech has been providing exceptional Digital services to many businesses in the San Gabriel Valley and beyond. Named by Awards as one of the Pakistani most innovative digital agencies, Digital Marketing specializes in the design & Web development of digital products, websites, eCommerce, and apps. We partner with organizations who want to do more, engage better, and disrupt their categories fast.

A domain name is simply another name for your website url, or website address. For example: There are many companies out there that offer great domain name registry services for a great price. If your paying somewhere between $20, to $30, to $40 per domain, you’re getting ripped off.

Web development service is the booming one among the many new and highly profitable business sectors in the World Wide Web. Undoubtedly the technology has brought a huge change in the business field through the internet. The development service of the web portals demands various processes to make the business legal one.

 

qattaftech.com/product/web-development/

 

qattaftechdigitalmarketingagency.blogspot.com/2021/05/cre...

 

Address : 266 Denton Lane,Chadderton, Oldham,Lancashire United Kingdom

Postal code : OL98P

Tel : +923094393314

971-999-9293

Mail : contact@qattaftech.com

 

 

62 views
0 faves
0 comments
Uploaded on August 5, 2021